Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins) |
Protein Thiol peroxidase Tpx [102452] (3 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [117600] (2 PDB entries) |
Domain d1y25a1: 1y25 A:3-165 [122554] complexed with act; mutant |
PDB Entry: 1y25 (more details), 2.1 Å
SCOP Domain Sequences for d1y25a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y25a1 c.47.1.10 (A:3-165) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} qitlrgnaintvgelpavgspapaftltggdlgvissdqfrgksvllnifpsvdtpvsat svrtfderaaasgatvlcvskdlpfaqkrfcgaegtenvmpasafrdsfgedygvtiadg pmagllaraivvigadgnvaytelvpeiaqepnyeaalaalga
Timeline for d1y25a1: