SCOP 1.75: Domain d1y0od1: 1y0o D:605-729

Lineage for d1y0od1 (1y0o D:605-729)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (3 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)

6. Protein FKBP13 [110870] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110871] (2 PDB entries)
   Uniprot Q9SCY2 84-208

8. Domain d1y0od1: 1y0o D:605-729 [122505]
   automatically matched to d1u79a_

Details for d1y0od1

PDB Entry: 1y0o, 1.89 Å

PDB Description: crystal structure of reduced AtFKBP13

PDB Compounds: (D:) FKBP-type peptidyl-prolyl cis-trans isomerase 3

SCOP Domain Sequences for d1y0od1:

Sequence; same for both SEQRES and ATOM records:

>d1y0od1 d.26.1.1 (D:605-729) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
cefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfrigvg
evikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvllfdie
yigka

Timeline for d1y0od1:

• d1y0od1 first appeared in SCOP 1.73
  
• d1y0od1 is called d1y0od_ in SCOPe 2.01
  
• d1y0od1 appears in the current release, SCOPe 2.08, called d1y0od_