![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
![]() | Protein Methane monooxygenase hydrolase alpha subunit [88789] (2 species) |
![]() | Species Methylococcus capsulatus [TaxId:414] [88790] (26 PDB entries) |
![]() | Domain d1xvfb_: 1xvf B: [122369] Other proteins in same PDB: d1xvfc_, d1xvfd_, d1xvfe_, d1xvff_ automated match to d1fz1a_ complexed with 3cl, fe has additional subdomain(s) that are not in the common domain |
PDB Entry: 1xvf (more details), 2 Å
SCOPe Domain Sequences for d1xvfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xvfb_ a.25.1.2 (B:) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus [TaxId: 414]} raptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkder qfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkngy laqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgda vecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvsi andpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggiw igrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeanyp gwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastlr vheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktlia qphvrgdklwtlddikrlncvfknpvkafn
Timeline for d1xvfb_: