Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species) |
Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries) |
Domain d1xu5d_: 1xu5 D: [122329] Other proteins in same PDB: d1xu5a_, d1xu5b_, d1xu5e_, d1xu5f_ automated match to d1fyzc_ complexed with fe, iph, oh |
PDB Entry: 1xu5 (more details), 1.96 Å
SCOPe Domain Sequences for d1xu5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xu5d_ a.25.1.2 (D:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]} smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd dwiedyasridfkadrdqivkavlaglk
Timeline for d1xu5d_: