SCOP 1.75: Domain d1xrxc1: 1xrx C:1-35

Lineage for d1xrxc1 (1xrx C:1-35)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (11 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.7: SeqA N-terminal domain-like [140547] (1 protein)
   N-terminal part of Pfam PF03925

6. Protein SeqA [140548] (1 species)
   a negative modulator of replication initiation

7. Species Escherichia coli [TaxId:562] [140549] (1 PDB entry)
   Uniprot P0AFY8 1-35

8. Domain d1xrxc1: 1xrx C:1-35 [122266]
   automatically matched to 1XRX A:1-35
   complexed with ca

Details for d1xrxc1

PDB Entry: 1xrx, 2.15 Å

PDB Description: Crystal structure of a DNA-binding protein

PDB Compounds: (C:) SeqA protein

SCOP Domain Sequences for d1xrxc1:

Sequence; same for both SEQRES and ATOM records:

>d1xrxc1 a.43.1.7 (C:1-35) SeqA {Escherichia coli [TaxId: 562]}
mktievddelysyiashtkhigesasdilrrmlkf

Timeline for d1xrxc1:

• d1xrxc1 first appeared in SCOP 1.73
  
• d1xrxc1 is called d1xrxc_ in SCOPe 2.01
  
• d1xrxc1 appears in the current release, SCOPe 2.08, called d1xrxc_