![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
![]() | Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) ![]() duplication: consists of two domains of this fold automatically mapped to Pfam PF02964 |
![]() | Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins) |
![]() | Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) |
![]() | Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries) |
![]() | Domain d1xmhe_: 1xmh E: [122163] Other proteins in same PDB: d1xmha_, d1xmhb_, d1xmhc_, d1xmhd_ automated match to d1fyzf_ complexed with co |
PDB Entry: 1xmh (more details), 2.32 Å
SCOPe Domain Sequences for d1xmhe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmhe_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]} aklgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakle ekvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykpp impvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs
Timeline for d1xmhe_: