Lineage for d1xmhd_ (1xmh D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703395Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 2703396Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)
  8. 2703430Domain d1xmhd_: 1xmh D: [122162]
    Other proteins in same PDB: d1xmha_, d1xmhb_, d1xmhe_, d1xmhf_
    automated match to d1fyzc_
    complexed with co

    has additional insertions and/or extensions that are not grouped together

Details for d1xmhd_

PDB Entry: 1xmh (more details), 2.32 Å

PDB Description: Structure of Co(II) reconstituted methane monooxygenase hydroxylase from M. capsulatus (Bath)
PDB Compounds: (D:) Methane monooxygenase component A beta chain

SCOPe Domain Sequences for d1xmhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmhd_ a.25.1.2 (D:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaevilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOPe Domain Coordinates for d1xmhd_:

Click to download the PDB-style file with coordinates for d1xmhd_.
(The format of our PDB-style files is described here.)

Timeline for d1xmhd_: