SCOP 1.73: Domain d1xkfa2: 1xkf A:69-124

Lineage for d1xkfa2 (1xkf A:69-124)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.37: CBS-domain [54630] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.37.1: CBS-domain [54631] (1 family)

5. Family d.37.1.1: CBS-domain [54632] (10 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain

6. Protein Hypothetical protein Rv2626c [143142] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [143143] (2 PDB entries)

8. Domain d1xkfa2: 1xkf A:69-124 [122078]
   complexed with zn

Details for d1xkfa2

PDB Entry: 1xkf, 1.9 Å

PDB Description: Crystal structure of Hypoxic Response Protein I (HRPI) with two coordinated zinc ions

PDB Compounds: (A:) hypothetical protein RV2626C

SCOP Domain Sequences for d1xkfa2:

Sequence, based on SEQRES records:

>d1xkfa2 d.37.1.1 (A:69-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]}
tagelardsiyyvdanasiqemlnvmeehqvrrvpvisehrlvgivteadiarhlp

Sequence, based on observed residues (ATOM records):

>d1xkfa2 d.37.1.1 (A:69-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]}
tagelaiyyvdanasiqemlnvmeehqvrrvpvisehrlvgivteadiarhlp

Timeline for d1xkfa2:

• d1xkfa2 is new in SCOP 1.73
  
• d1xkfa2 does not appear in SCOP 1.75