SCOP 1.73: Domain d1xkfb1: 1xkf B:2-68

Lineage for d1xkfb1 (1xkf B:2-68)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.37: CBS-domain [54630] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.37.1: CBS-domain [54631] (1 family)

5. Family d.37.1.1: CBS-domain [54632] (10 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain

6. Protein Hypothetical protein Rv2626c [143142] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [143143] (2 PDB entries)

8. Domain d1xkfb1: 1xkf B:2-68 [122079]
   automatically matched to 1XKF A:2-68
   complexed with zn

Details for d1xkfb1

PDB Entry: 1xkf, 1.9 Å

PDB Description: Crystal structure of Hypoxic Response Protein I (HRPI) with two coordinated zinc ions

PDB Compounds: (B:) hypothetical protein RV2626C

SCOP Domain Sequences for d1xkfb1:

Sequence; same for both SEQRES and ATOM records:

>d1xkfb1 d.37.1.1 (B:2-68) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]}
ttardimnagvtcvgehetltaaaqymrehdigalpicgdddrlhgmltdrdivikglaa
gldpnta

Timeline for d1xkfb1:

• d1xkfb1 is new in SCOP 1.73
  
• d1xkfb1 does not appear in SCOP 1.75