![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) ![]() |
![]() | Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) |
![]() | Protein Aspartate carbamoyltransferase [54895] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [54896] (41 PDB entries) |
![]() | Domain d1xjwb1: 1xjw B:1-100 [122043] Other proteins in same PDB: d1xjwa1, d1xjwa2, d1xjwb2, d1xjwc1, d1xjwc2, d1xjwd2 automatically matched to d1d09b1 complexed with pal, zn; mutant |
PDB Entry: 1xjw (more details), 2.71 Å
SCOP Domain Sequences for d1xjwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xjwb1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]} mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik ientflsedqvdqlalyapqatvnridnyevvgksrpslp
Timeline for d1xjwb1: