Lineage for d1xfbb_ (1xfb B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571860Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1571861Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1572356Protein automated matches [190095] (19 species)
    not a true protein
  7. 1572440Species Human (Homo sapiens) [TaxId:9606] [254965] (1 PDB entry)
  8. 1572441Domain d1xfbb_: 1xfb B: [121923]
    Other proteins in same PDB: d1xfba1
    automated match to d1ewda_

Details for d1xfbb_

PDB Entry: 1xfb (more details), 3 Å

PDB Description: Human Brain Fructose 1,6-(bis)phosphate Aldolase (C isozyme)
PDB Compounds: (B:) Aldolase C

SCOPe Domain Sequences for d1xfbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfbb_ c.1.10.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv
lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge
tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng
ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi
kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy
gralqasalnawrgqrdnagaateefikraevnglaaqgkye

SCOPe Domain Coordinates for d1xfbb_:

Click to download the PDB-style file with coordinates for d1xfbb_.
(The format of our PDB-style files is described here.)

Timeline for d1xfbb_: