Lineage for d1xbia1 (1xbi A:2-116)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727288Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 727493Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 727494Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 727506Protein Ribosomal protein L7ae [55319] (4 species)
  7. 727551Species Archaeon Methanococcus jannaschii [TaxId:2190] [111033] (3 PDB entries)
  8. 727552Domain d1xbia1: 1xbi A:2-116 [121840]
    automatically matched to d1sdsa_
    complexed with epe

Details for d1xbia1

PDB Entry: 1xbi (more details), 1.45 Å

PDB Description: high resolution structure of methanocaldococcus jannaschii l7ae
PDB Compounds: (A:) 50S ribosomal protein L7Ae

SCOP Domain Sequences for d1xbia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]}
avyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvahl
pylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlk

SCOP Domain Coordinates for d1xbia1:

Click to download the PDB-style file with coordinates for d1xbia1.
(The format of our PDB-style files is described here.)

Timeline for d1xbia1: