Lineage for d1xbia1 (1xbi A:1-116)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.3: L30e-like [55315] (4 families) 
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) 
Protein Ribosomal protein L7ae [55319] (7 species) Species Methanococcus jannaschii [TaxId:2190] [111033] (3 PDB entries)
Uniprot P54066
Domain d1xbia1: 1xbi A:1-116 [121840]
Other proteins in same PDB: d1xbia2
automatically matched to d1sdsa_
protein/RNA complex; complexed with epe
Details for d1xbia1
PDB Entry: 1xbi (more details), 1.45 Å
PDB Description: high resolution structure of methanocaldococcus jannaschii l7ae
PDB Compounds: (A:) 50S ribosomal protein L7AeSCOPe Domain Sequences for d1xbia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xbia1 d.79.3.1 (A:1-116) Ribosomal protein L7ae {Methanococcus jannaschii [TaxId: 2190]}
mavyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvah
lpylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlk
SCOPe Domain Coordinates for d1xbia1:
Click to download the PDB-style file with coordinates for d1xbia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xbia1:
- d1xbia1 first appeared in SCOP 1.73
- d1xbia1 appears in SCOPe 2.07
View in 3D
