Lineage for d1x6va2 (1x6v A:390-624)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469031Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins)
    automatically mapped to Pfam PF01747
  6. 2469032Protein ATP sulfurylase catalytic domain [63980] (5 species)
  7. 2469055Species Human (Homo sapiens) [TaxId:9606] [142082] (3 PDB entries)
    Uniprot O43252 390-624
  8. 2469056Domain d1x6va2: 1x6v A:390-624 [121756]
    Other proteins in same PDB: d1x6va1, d1x6va3, d1x6va4, d1x6vb1, d1x6vb3
    complexed with adp, cl

Details for d1x6va2

PDB Entry: 1x6v (more details), 1.75 Å

PDB Description: the crystal structure of human 3'-phosphoadenosine-5'-phosphosulfate synthetase 1
PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1

SCOPe Domain Sequences for d1x6va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6va2 c.26.1.5 (A:390-624) ATP sulfurylase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ndgldqyrltptelkqkfkdmnadavsafqlrnpvhnghallmqdthkqllergyrrpvl
llhplggwtkdddvplmwrmkqhaavleegvlnpettvvaifpspmmyagptevqwhcra
rmvaganfyivgrdpagmphpetgkdlyepshgakvltmapglitleivpfrvaaynkkk
krmdyydsehhedfefisgtrmrklaregqkppegfmapkawtvlteyyksleka

SCOPe Domain Coordinates for d1x6va2:

Click to download the PDB-style file with coordinates for d1x6va2.
(The format of our PDB-style files is described here.)

Timeline for d1x6va2: