Lineage for d1x53a1 (1x53 A:8-139)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582337Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
    Pfam PF05146
  6. 2582338Protein Activator of 90 kda heat shock protein ATPase homolog 1, AHSA1 [143833] (1 species)
  7. 2582339Species Human (Homo sapiens) [TaxId:9606] [143834] (1 PDB entry)
    Uniprot O95433 204-335
  8. 2582340Domain d1x53a1: 1x53 A:8-139 [121703]
    Other proteins in same PDB: d1x53a2, d1x53a3

Details for d1x53a1

PDB Entry: 1x53 (more details)

PDB Description: the solution structure of the c-terminal domain of human activator of 90 kda heat shock protein atpase homolog 1
PDB Compounds: (A:) Activator of 90 kDa heat shock protein ATPase homolog 1

SCOPe Domain Sequences for d1x53a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x53a1 d.129.3.5 (A:8-139) Activator of 90 kda heat shock protein ATPase homolog 1, AHSA1 {Human (Homo sapiens) [TaxId: 9606]}
iptckitlketfltspeelyrvfttqelvqafthapatleadrggkfhmvdgnvsgeftd
lvpekhivmkwrfkswpeghfatitltfidkngetelcmegrgipapeeertrqgwqryy
fegikqtfgyga

SCOPe Domain Coordinates for d1x53a1:

Click to download the PDB-style file with coordinates for d1x53a1.
(The format of our PDB-style files is described here.)

Timeline for d1x53a1: