Lineage for d1x0ra1 (1x0r A:2-242)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2485379Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2485575Protein Peroxiredoxin [117601] (1 species)
  7. 2485576Species Aeropyrum pernix [TaxId:56636] [117602] (2 PDB entries)
    Uniprot Q9Y9L0 # APE2278
  8. 2485577Domain d1x0ra1: 1x0r A:2-242 [121562]
    complexed with edo

Details for d1x0ra1

PDB Entry: 1x0r (more details), 2 Å

PDB Description: thioredoxin peroxidase from aeropyrum pernix k1
PDB Compounds: (A:) Probable peroxiredoxin

SCOPe Domain Sequences for d1x0ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0ra1 c.47.1.10 (A:2-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]}
pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
geglivpppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpakll
y

SCOPe Domain Coordinates for d1x0ra1:

Click to download the PDB-style file with coordinates for d1x0ra1.
(The format of our PDB-style files is described here.)

Timeline for d1x0ra1: