Lineage for d1x0ma1 (1x0m A:26-428)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 840449Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 840450Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) (S)
  5. 840451Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 840704Protein Hypothetical aminotransferase PH0207 [142657] (1 species)
  7. 840705Species Archaeon Pyrococcus horikoshii [TaxId:53953] [142658] (1 PDB entry)
    Uniprot O57946 26-428
  8. 840706Domain d1x0ma1: 1x0m A:26-428 [121550]

Details for d1x0ma1

PDB Entry: 1x0m (more details), 2.2 Å

PDB Description: a Human Kynurenine Aminotransferase II Homologue from Pyrococcus horikoshii OT3
PDB Compounds: (A:) Aminotransferase II Homologue

SCOP Domain Sequences for d1x0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0ma1 c.67.1.1 (A:26-428) Hypothetical aminotransferase PH0207 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mlgdverffskkalemrasevrellklvetsdiislagglpnpktfpkeiirdilveime
kyadkalqygttkgftplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpgd
ivvveaptylaalqafnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvpt
fqnpagvtmnedrrkyllelaseydfivveddpygelrysgnpekkikaldnegrviylg
tfskilapgfrigwmvgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipei
rkfykprrdamlealeefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayvp
geafyahrdvkntmrlnftyvdedkimegikrlaetikeelka

SCOP Domain Coordinates for d1x0ma1:

Click to download the PDB-style file with coordinates for d1x0ma1.
(The format of our PDB-style files is described here.)

Timeline for d1x0ma1: