PDB entry 1x0m

View 1x0m on RCSB PDB site
Description: a Human Kynurenine Aminotransferase II Homologue from Pyrococcus horikoshii OT3
Class: transferase
Keywords: aminotransferase
Deposited on 2005-03-24, released 2005-04-12
The last revision prior to the SCOP 1.75 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminotransferase II Homologue
    Species: Pyrococcus horikoshii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1x0ma1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x0mA (A:)
    mlgdverffskkalemrasevrellklvetsdiislagglpnpktfpkeiirdilveime
    kyadkalqygttkgftplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpgd
    ivvveaptylaalqafnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvpt
    fqnpagvtmnedrrkyllelaseydfivveddpygelrysgnpekkikaldnegrviylg
    tfskilapgfrigwmvgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipei
    rkfykprrdamlealeefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayvp
    geafyahrdvkntmrlnftyvdedkimegikrlaetikeelka