Lineage for d1wzmb2 (1wzm B:503-585)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810619Protein Maltogenic amylase [51031] (4 species)
  7. 2810633Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (12 PDB entries)
  8. 2810649Domain d1wzmb2: 1wzm B:503-585 [121523]
    Other proteins in same PDB: d1wzma1, d1wzma3, d1wzmb1, d1wzmb3
    automatically matched to d1bvza2
    complexed with ca

Details for d1wzmb2

PDB Entry: 1wzm (more details), 3.2 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase ii (tva ii) mutatnt r469k
PDB Compounds: (B:) alpha-amylase II

SCOPe Domain Sequences for d1wzmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzmb2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOPe Domain Coordinates for d1wzmb2:

Click to download the PDB-style file with coordinates for d1wzmb2.
(The format of our PDB-style files is described here.)

Timeline for d1wzmb2: