Lineage for d1wzlb2 (1wzl B:503-585)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2811194Species Thermoactinomyces vulgaris [TaxId:2026] [254921] (8 PDB entries)
  8. 2811199Domain d1wzlb2: 1wzl B:503-585 [121517]
    Other proteins in same PDB: d1wzla1, d1wzla3, d1wzlb1, d1wzlb3
    automated match to d1wzlb2
    complexed with ca

Details for d1wzlb2

PDB Entry: 1wzl (more details), 2 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase ii (tva ii) mutatnt r469l
PDB Compounds: (B:) alpha-amylase II

SCOPe Domain Sequences for d1wzlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzlb2 b.71.1.0 (B:503-585) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOPe Domain Coordinates for d1wzlb2:

Click to download the PDB-style file with coordinates for d1wzlb2.
(The format of our PDB-style files is described here.)

Timeline for d1wzlb2: