Lineage for d1wokb2 (1wok B:797-1011)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606368Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2606369Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2606665Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2606666Protein automated matches [191197] (12 species)
    not a true protein
  7. 2606733Species Human (Homo sapiens) [TaxId:9606] [225406] (55 PDB entries)
  8. 2606843Domain d1wokb2: 1wok B:797-1011 [121119]
    Other proteins in same PDB: d1woka1, d1wokb1, d1wokc1, d1wokd1
    automated match to d4hhyd2
    complexed with cnq

Details for d1wokb2

PDB Entry: 1wok (more details), 3 Å

PDB Description: crystal structure of catalytic domain of human poly(adp-ribose) polymerase complexed with a quinoxaline-type inhibitor
PDB Compounds: (B:) Poly [ADP-ribose] polymerase-1

SCOPe Domain Sequences for d1wokb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wokb2 d.166.1.0 (B:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d1wokb2:

Click to download the PDB-style file with coordinates for d1wokb2.
(The format of our PDB-style files is described here.)

Timeline for d1wokb2: