SCOPe 2.07: Domain d1wkja1: 1wkj A:1-137

Lineage for d1wkja1 (1wkj A:1-137)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Thermus thermophilus [TaxId:274] [143289] (3 PDB entries)
   Uniprot Q5SLV5 1-137

8. Domain d1wkja1: 1wkj A:1-137 [120983]

Details for d1wkja1

PDB Entry: 1wkj, 2 Å

PDB Description: Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1wkja1:

Sequence; same for both SEQRES and ATOM records:

>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]}
mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
edaqreialffrpeell

Timeline for d1wkja1:

• d1wkja1 first appeared in SCOP 1.73
  
• d1wkja1 appears in SCOPe 2.06
  
• d1wkja1 appears in the current release, SCOPe 2.08