Lineage for d1wbba4 (1wbb A:2-116)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958349Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2958380Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (2 families) (S)
    automatically mapped to Pfam PF01624
  5. 2958406Family d.75.2.0: automated matches [254200] (1 protein)
    not a true family
  6. 2958407Protein automated matches [254440] (1 species)
    not a true protein
  7. 2958408Species Escherichia coli [TaxId:562] [254937] (3 PDB entries)
  8. 2958410Domain d1wbba4: 1wbb A:2-116 [120840]
    Other proteins in same PDB: d1wbba1, d1wbba2, d1wbba3, d1wbbb1, d1wbbb2, d1wbbb3
    automated match to d1w7aa4
    protein/DNA complex; complexed with adp, mg; mutant

Details for d1wbba4

PDB Entry: 1wbb (more details), 2.5 Å

PDB Description: crystal structure of e. coli dna mismatch repair enzyme muts, e38a mutant, in complex with a g.t mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1wbba4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbba4 d.75.2.0 (A:2-116) automated matches {Escherichia coli [TaxId: 562]}
saienfdahtpmmqqylrlkaqhpeillfyrmgdfyalfyddakrasqlldisltkrgas
agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

SCOPe Domain Coordinates for d1wbba4:

Click to download the PDB-style file with coordinates for d1wbba4.
(The format of our PDB-style files is described here.)

Timeline for d1wbba4: