Lineage for d1w7va1 (1w7v A:1-176)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701913Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) (S)
  5. 701914Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)
  6. 701915Protein Aminopeptidase P [53096] (2 species)
    synonym: Xaa-Pro dipeptidase, prolidase
  7. 701919Species Escherichia coli [TaxId:562] [53097] (23 PDB entries)
  8. 701925Domain d1w7va1: 1w7v A:1-176 [120691]
    Other proteins in same PDB: d1w7va2, d1w7vb2, d1w7vc2, d1w7vd2
    automatically matched to d1a16_1
    complexed with cl, mg, zn

Details for d1w7va1

PDB Entry: 1w7v (more details), 2 Å

PDB Description: znmg substituted aminopeptidase p from e. coli
PDB Compounds: (A:) xaa-pro aminopeptidase

SCOP Domain Sequences for d1w7va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7va1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

SCOP Domain Coordinates for d1w7va1:

Click to download the PDB-style file with coordinates for d1w7va1.
(The format of our PDB-style files is described here.)

Timeline for d1w7va1: