Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) |
Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins) |
Protein Aminopeptidase P, C-terminal domain [55928] (2 species) |
Species Escherichia coli [TaxId:562] [55929] (23 PDB entries) |
Domain d1w7vb2: 1w7v B:177-439 [120694] Other proteins in same PDB: d1w7va1, d1w7vb1, d1w7vc1, d1w7vd1 automatically matched to d1a16_2 complexed with cl, mg, zn |
PDB Entry: 1w7v (more details), 2 Å
SCOP Domain Sequences for d1w7vb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w7vb2 d.127.1.1 (B:177-439) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]} speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn enltasvvkkpeeiealmvaark
Timeline for d1w7vb2: