SCOPe 2.03: Domain d1w35a2: 1w35 A:142-302

Lineage for d1w35a2 (1w35 A:142-302)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (5 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species)

7. Species Anabaena sp., pcc 7119 [TaxId:1167] [52350] (24 PDB entries)

8. Domain d1w35a2: 1w35 A:142-302 [120623]
   Other proteins in same PDB: d1w35a1
   automatically matched to d1e62a2
   complexed with fad, so4; mutant

Details for d1w35a2

PDB Entry: 1w35, 1.9 Å

PDB Description: ferredoxin-nadp+ reductase (mutation: y 303 w)

PDB Compounds: (A:) ferredoxin-nadp+ reductase

SCOPe Domain Sequences for d1w35a2:

Sequence; same for both SEQRES and ATOM records:

>d1w35a2 c.25.1.1 (A:142-302) Ferredoxin reductase (flavodoxin reductase) {Anabaena sp., pcc 7119 [TaxId: 1167]}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvet

Timeline for d1w35a2:

• d1w35a2 first appeared in SCOP 1.73
  
• d1w35a2 appears in SCOPe 2.02
  
• d1w35a2 appears in SCOPe 2.04
  
• d1w35a2 appears in the current release, SCOPe 2.08