Lineage for d1vqol1 (1vqo L:1-150)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852065Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 2852066Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 2852067Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 2852068Protein Ribosomal protein L15 (L15p) [52082] (4 species)
  7. 2852106Species Haloarcula marismortui [TaxId:2238] [52083] (40 PDB entries)
    Uniprot P12737
  8. 2852108Domain d1vqol1: 1vqo L:1-150 [120373]
    Other proteins in same PDB: d1vqo11, d1vqo21, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqog1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1
    automatically matched to d1ffkj_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqol1

PDB Entry: 1vqo (more details), 2.2 Å

PDB Description: The structure of CCPMN bound to the large ribosomal subunit haloarcula marismortui
PDB Compounds: (L:) 50S ribosomal protein L15P

SCOPe Domain Sequences for d1vqol1:

Sequence, based on SEQRES records: (download)

>d1vqol1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records): (download)

>d1vqol1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

SCOPe Domain Coordinates for d1vqol1:

Click to download the PDB-style file with coordinates for d1vqol1.
(The format of our PDB-style files is described here.)

Timeline for d1vqol1: