![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.3: L30e-like [55315] (4 families) ![]() |
![]() | Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
![]() | Protein Ribosomal protein L7ae [55319] (7 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries) Uniprot P12743 |
![]() | Domain d1vqof1: 1vqo F:1-119 [120368] Other proteins in same PDB: d1vqo11, d1vqo21, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqog1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1 automatically matched to d1s72f_ protein/RNA complex; complexed with cd, cl, k, mg, na, sr |
PDB Entry: 1vqo (more details), 2.2 Å
SCOPe Domain Sequences for d1vqof1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]} pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr
Timeline for d1vqof1:
![]() Domains from other chains: (mouse over for more information) d1vqo11, d1vqo21, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqog1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1 |