![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (2 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins) |
![]() | Protein Pprobable purine phosphoribosyltransferase PH0095 [142560] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [142561] (1 PDB entry) Uniprot O57827 1-153 |
![]() | Domain d1vdmg1: 1vdm G:1-152 [120000] automatically matched to 1VDM A:1-153 |
PDB Entry: 1vdm (more details), 2.5 Å
SCOP Domain Sequences for d1vdmg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vdmg1 c.61.1.1 (G:1-152) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]} mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf ykgidergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiacla mkpwtsvvpdyyvfrtekwivfpweefpviek
Timeline for d1vdmg1: