Lineage for d1vdmg1 (1vdm G:1-152)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 703952Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 703953Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 703954Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)
  6. 704101Protein Pprobable purine phosphoribosyltransferase PH0095 [142560] (1 species)
  7. 704102Species Pyrococcus horikoshii [TaxId:53953] [142561] (1 PDB entry)
  8. 704109Domain d1vdmg1: 1vdm G:1-152 [120000]
    automatically matched to 1VDM A:1-153

Details for d1vdmg1

PDB Entry: 1vdm (more details), 2.5 Å

PDB Description: Crystal structure of purine phosphoribosyltransferase from Pyrococcus horikoshii Ot3
PDB Compounds: (G:) purine phosphoribosyltransferase

SCOP Domain Sequences for d1vdmg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdmg1 c.61.1.1 (G:1-152) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]}
mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
ykgidergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiacla
mkpwtsvvpdyyvfrtekwivfpweefpviek

SCOP Domain Coordinates for d1vdmg1:

Click to download the PDB-style file with coordinates for d1vdmg1.
(The format of our PDB-style files is described here.)

Timeline for d1vdmg1: