Lineage for d1uhhb_ (1uhh B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1268647Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1269002Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1269511Protein automated matches [190064] (15 species)
    not a true protein
  7. 1269549Species Jellyfish (Aequorea victoria) [TaxId:6100] [186782] (4 PDB entries)
  8. 1269553Domain d1uhhb_: 1uhh B: [119676]
    automated match to d1ej3a_
    complexed with czp

Details for d1uhhb_

PDB Entry: 1uhh (more details), 1.8 Å

PDB Description: Crystal structure of cp-aequorin
PDB Compounds: (B:) Aequorin 2

SCOPe Domain Sequences for d1uhhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhhb_ a.39.1.5 (B:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav
eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng
aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek
lyggavp

SCOPe Domain Coordinates for d1uhhb_:

Click to download the PDB-style file with coordinates for d1uhhb_.
(The format of our PDB-style files is described here.)

Timeline for d1uhhb_: