SCOP 1.73: Domain d1u6ea1: 1u6e A:-10-174

Lineage for d1u6ea1 (1u6e A:-10-174)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)

6. Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [64196] (6 PDB entries)

8. Domain d1u6ea1: 1u6e A:-10-174 [119568]
   automatically matched to d1hzpa1
   complexed with cl; mutant

Details for d1u6ea1

PDB Entry: 1u6e, 1.85 Å

PDB Description: 1.85 angstrom crystal structure of the c112a mutant of mycobacterium tuberculosis beta-ketoacyl-acyl carrier protein synthase iii (fabh)

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase III

SCOP Domain Sequences for d1u6ea1:

Sequence; same for both SEQRES and ATOM records:

>d1u6ea1 c.95.1.2 (A:-10-174) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
gaagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
fqgi

Timeline for d1u6ea1:

• d1u6ea1 is new in SCOP 1.73
  
• d1u6ea1 appears in SCOP 1.75
  
• d1u6ea1 appears in the current release, SCOPe 2.08