![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
![]() | Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
![]() | Protein automated matches [190061] (4 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [186780] (70 PDB entries) |
![]() | Domain d1u1ba_: 1u1b A: [119419] automated match to d1a2wa_ complexed with pax |
PDB Entry: 1u1b (more details), 2 Å
SCOPe Domain Sequences for d1u1ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u1ba_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf dasv
Timeline for d1u1ba_: