Lineage for d1u0oa_ (1u0o A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2558907Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2559212Protein Snake coagglutinin alpha chain [88861] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 2559229Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88864] (4 PDB entries)
  8. 2559233Domain d1u0oa_: 1u0o A: [119409]
    Other proteins in same PDB: d1u0ob_, d1u0oc1
    automated match to d1fvua_

Details for d1u0oa_

PDB Entry: 1u0o (more details), 2.7 Å

PDB Description: The mouse von Willebrand Factor A1-botrocetin complex
PDB Compounds: (A:) Botrocetin

SCOPe Domain Sequences for d1u0oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0oa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
aqknpfvcksppp

SCOPe Domain Coordinates for d1u0oa_:

Click to download the PDB-style file with coordinates for d1u0oa_.
(The format of our PDB-style files is described here.)

Timeline for d1u0oa_: