SCOPe 2.08: Domain d1u0na_: 1u0n A:

Lineage for d1u0na_ (1u0n A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)

6. Protein automated matches [190060] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186779] (22 PDB entries)

8. Domain d1u0na_: 1u0n A: [119405]
   Other proteins in same PDB: d1u0nb_, d1u0nc_, d1u0nd_
   automated match to d1auq__

Details for d1u0na_

PDB Entry: 1u0n, 2.95 Å

PDB Description: the ternary von willebrand factor a1-glycoprotein ibalpha-botrocetin complex

PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d1u0na_:

Sequence; same for both SEQRES and ATOM records:

>d1u0na_ c.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
disepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavve
yhdgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasri
alllmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvl
ssvdeleqqrdeivsylcdlapeapppt

Timeline for d1u0na_:

• d1u0na_ first appeared in SCOP 1.73, called d1u0na1
  
• d1u0na_ appears in SCOPe 2.07