SCOPe 2.08: Domain d1sqxf_: 1sqx F:

Lineage for d1sqxf_ (1sqx F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex
   automatically mapped to Pfam PF02271

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein automated matches [190325] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [192447] (4 PDB entries)

8. Domain d1sqxf_: 1sqx F: [119043]
   Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxe1, d1sqxe2, d1sqxg_, d1sqxh_, d1sqxi_, d1sqxj_, d1sqxk_
   automated match to d1qcrf_
   complexed with fes, hec, sma, uq2

Details for d1sqxf_

PDB Entry: 1sqx, 2.6 Å

PDB Description: crystal structure analysis of bovine bc1 with stigmatellin a

PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOPe Domain Sequences for d1sqxf_:

Sequence; same for both SEQRES and ATOM records:

>d1sqxf_ f.27.1.1 (F:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

Timeline for d1sqxf_:

• d1sqxf_ first appeared in SCOP 1.73, called d1sqxf1
  
• d1sqxf_ appears in SCOPe 2.07