Lineage for d1sqva1 (1sqv A:1-233)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005156Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 3005157Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 3005158Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 3005159Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 3005188Species Cow (Bos taurus) [TaxId:9913] [55997] (19 PDB entries)
    Uniprot P31800
  8. 3005219Domain d1sqva1: 1sqv A:1-233 [119020]
    Other proteins in same PDB: d1sqvb1, d1sqvb2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqve1, d1sqve2, d1sqvf_, d1sqvg_, d1sqvh_, d1sqvi_, d1sqvj_, d1sqvk_
    automated match to d1ntma1
    complexed with fes, hec, uhd, uq2

Details for d1sqva1

PDB Entry: 1sqv (more details), 2.85 Å

PDB Description: crystal structure analysis of bovine bc1 with uhdbt
PDB Compounds: (A:) Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial

SCOPe Domain Sequences for d1sqva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqva1 d.185.1.1 (A:1-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]}
tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlsp

SCOPe Domain Coordinates for d1sqva1:

Click to download the PDB-style file with coordinates for d1sqva1.
(The format of our PDB-style files is described here.)

Timeline for d1sqva1: