Lineage for d1sqqc1 (1sqq C:261-379)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2580258Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 2580259Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 2580327Family f.32.1.0: automated matches [254197] (1 protein)
    not a true family
  6. 2580328Protein automated matches [254431] (4 species)
    not a true protein
  7. Species Cow (Bos taurus) [TaxId:9913] [254896] (2 PDB entries)
  8. 2580341Domain d1sqqc1: 1sqq C:261-379 [119011]
    Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqi_, d1sqqj_, d1sqqk1
    automated match to d2a06c2
    complexed with fes, hem, ost, uq2

Details for d1sqqc1

PDB Entry: 1sqq (more details), 3 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Methoxy Acrylate Stilbene (MOAS)
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d1sqqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqc1 f.32.1.0 (C:261-379) automated matches {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

SCOPe Domain Coordinates for d1sqqc1:

Click to download the PDB-style file with coordinates for d1sqqc1.
(The format of our PDB-style files is described here.)

Timeline for d1sqqc1: