Lineage for d1sqpb2 (1sqp B:236-439)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2562006Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2562007Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2562008Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 2562083Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 2562112Species Cow (Bos taurus) [TaxId:9913] [56000] (19 PDB entries)
    Uniprot P23004
  8. 2562148Domain d1sqpb2: 1sqp B:236-439 [118998]
    Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpe1, d1sqpe2, d1sqpf1, d1sqpg_, d1sqph_, d1sqpi_, d1sqpj_, d1sqpk1
    automated match to d1sqbb2
    complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpb2

PDB Entry: 1sqp (more details), 2.7 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Myxothiazol
PDB Compounds: (B:) Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial precursor

SCOPe Domain Sequences for d1sqpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqpb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

SCOPe Domain Coordinates for d1sqpb2:

Click to download the PDB-style file with coordinates for d1sqpb2.
(The format of our PDB-style files is described here.)

Timeline for d1sqpb2: