Lineage for d1rp8a1 (1rp8 A:348-404)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2419801Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2420203Protein Plant alpha-amylase [51040] (2 species)
    single beta-sheet; probable result of a decay of the common-fold
  7. 2420204Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89384] (7 PDB entries)
  8. 2420211Domain d1rp8a1: 1rp8 A:348-404 [118783]
    Other proteins in same PDB: d1rp8a2
    automated match to d1ht6a1
    complexed with ca; mutant

Details for d1rp8a1

PDB Entry: 1rp8 (more details), 2 Å

PDB Description: crystal structure of barley alpha-amylase isozyme 1 (amy1) inactive mutant d180a in complex with maltoheptaose
PDB Compounds: (A:) Alpha-amylase type 1 isozyme

SCOPe Domain Sequences for d1rp8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rp8a1 b.71.1.1 (A:348-404) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]}
itatsalkilmhegdayvaeidgkvvvkigsrydvgavipagfvtsahgndyavwek

SCOPe Domain Coordinates for d1rp8a1:

Click to download the PDB-style file with coordinates for d1rp8a1.
(The format of our PDB-style files is described here.)

Timeline for d1rp8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rp8a2