Lineage for d1r9na2 (1r9n A:509-766)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508876Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 2508883Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 2508884Species Human (Homo sapiens) [TaxId:9606] [82499] (58 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2508965Domain d1r9na2: 1r9n A:509-766 [118746]
    Other proteins in same PDB: d1r9na1, d1r9nb1, d1r9nb3, d1r9nc1, d1r9nd1
    automatically matched to d1orva2
    complexed with nag

Details for d1r9na2

PDB Entry: 1r9n (more details), 2.3 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv in complex with a decapeptide (tnpy) at 2.3 ang. resolution
PDB Compounds: (A:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1r9na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9na2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d1r9na2:

Click to download the PDB-style file with coordinates for d1r9na2.
(The format of our PDB-style files is described here.)

Timeline for d1r9na2: