Lineage for d1ohsb_ (1ohs B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1405093Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1405183Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 1405184Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 1405185Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (21 PDB entries)
  8. 1405196Domain d1ohsb_: 1ohs B: [118707]
    automated match to d1qjga_
    complexed with 5sd; mutant

Details for d1ohsb_

PDB Entry: 1ohs (more details), 1.7 Å

PDB Description: crystal structure of 5-3-ketosteroid isomerase mutant y14f/ d38n from pseudomonas testosteroni complexed with androstanedione
PDB Compounds: (B:) steroid delta-isomerase

SCOPe Domain Sequences for d1ohsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohsb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}
mntpehmtavvqrfvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
ihaga

SCOPe Domain Coordinates for d1ohsb_:

Click to download the PDB-style file with coordinates for d1ohsb_.
(The format of our PDB-style files is described here.)

Timeline for d1ohsb_: