Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (19 species) |
Species Mouse (Mus musculus) [TaxId:10090] [51861] (1 PDB entry) |
Domain d2ldxb1: 2ldx B:1-159 [118642] Other proteins in same PDB: d2ldxa2, d2ldxb2, d2ldxc2, d2ldxd2 duplicate of 2LDX 1-159 |
PDB Entry: 2ldx (more details), 2.96 Å
SCOPe Domain Sequences for d2ldxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ldxb1 c.2.1.5 (B:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} stvkeqliqnlvpedklsrckitvvgvgdvgmacaisillkgladelalvdadtdklrge aldlqhgslflstpkivfgkdynvsansklviitagarmvsgqtrldllqrnvaimkaiv pgviqnspdckiivvtnpvdiltyvvwkisgfpvgrvig
Timeline for d2ldxb1: