Lineage for d1cycb_ (1cyc B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476826Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1476827Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1476828Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1477026Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 1477098Species Bonito (Katsuwonus pelamis) [TaxId:8226] [46647] (1 PDB entry)
  8. 1477100Domain d1cycb_: 1cyc B: [118450]
    duplicate of 1CYC
    complexed with hem

Details for d1cycb_

PDB Entry: 1cyc (more details), 2.3 Å

PDB Description: the crystal structure of bonito (katsuo) ferrocytochrome c at 2.3 angstroms resolution. ii. structure and function
PDB Compounds: (B:) ferrocytochrome c

SCOPe Domain Sequences for d1cycb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cycb_ a.3.1.1 (B:) Mitochondrial cytochrome c {Bonito (Katsuwonus pelamis) [TaxId: 8226]}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
entlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

SCOPe Domain Coordinates for d1cycb_:

Click to download the PDB-style file with coordinates for d1cycb_.
(The format of our PDB-style files is described here.)

Timeline for d1cycb_: