Lineage for d2bena_ (2ben A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1299506Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 1299531Protein Chitin-binding protein CBP21 [117045] (1 species)
    member of Pfam PF03067; elaborated fold with a large insertion between strands A and A'
  7. 1299532Species Serratia marcescens [TaxId:615] [117046] (2 PDB entries)
    Uniprot O83009 28-197
  8. 1299536Domain d2bena_: 2ben A: [116701]
    mutant

Details for d2bena_

PDB Entry: 2ben (more details), 1.8 Å

PDB Description: crystal structure of the serratia marcescens chitin-binding protein cbp21 y54a mutant.
PDB Compounds: (A:) cbp21

SCOPe Domain Sequences for d2bena_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bena_ b.1.18.2 (A:) Chitin-binding protein CBP21 {Serratia marcescens [TaxId: 615]}
hgyvespasrayqcklqlntqcgsvqaepqsveglkgfpqagpadghiasadkstffeld
qqtptrwnklnlktgpnsftwkltarhsttswryfitkpnwdasqpltrasfdltpfcqf
ndggaipaaqvthqcnipadrsgshvilavwdiadtanafyqaidvnlsk

SCOPe Domain Coordinates for d2bena_:

Click to download the PDB-style file with coordinates for d2bena_.
(The format of our PDB-style files is described here.)

Timeline for d2bena_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2benb_