Lineage for d1y1yf_ (1y1y F:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1712169Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 1712170Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 1712171Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 1712172Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 1712173Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 1712274Domain d1y1yf_: 1y1y F: [116381]
    protein/DNA complex; protein/RNA complex

Details for d1y1yf_

PDB Entry: 1y1y (more details), 4 Å

PDB Description: rna polymerase ii-tfiis-dna/rna complex
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOPe Domain Sequences for d1y1yf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y1yf_ i.8.1.1 (F:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOPe Domain Coordinates for d1y1yf_:

Click to download the PDB-style file with coordinates for d1y1yf_.
(The format of our PDB-style files is described here.)

Timeline for d1y1yf_: