SCOPe 2.03: Domain d1y08a_: 1y08 A:

Lineage for d1y08a_ (1y08 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.12: IgG-specific endopeptidase IdeS (Sib38) [117762] (2 proteins)
   automatically mapped to Pfam PF09028

6. Protein IgG-specific endopeptidase IdeS (Sib38) [117763] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [117764] (2 PDB entries)
   Uniprot Q9F1R7 38-339 # SPy0861

8. Domain d1y08a_: 1y08 A: [116280]
   complexed with so4

Details for d1y08a_

PDB Entry: 1y08, 1.93 Å

PDB Description: structure of the streptococcal endopeptidase ides, a novel cysteine proteinase with strict specificity for igg

PDB Compounds: (A:) hypothetical protein SPy0861

SCOPe Domain Sequences for d1y08a_:

Sequence, based on SEQRES records:

>d1y08a_ d.3.1.12 (A:) IgG-specific endopeptidase IdeS (Sib38) {Streptococcus pyogenes [TaxId: 1314]}
tsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllsgaatagnmlhwwfd
qnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylstkh
lgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdfk
eknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyvtdsdsn
asigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqtn

Sequence, based on observed residues (ATOM records):

>d1y08a_ d.3.1.12 (A:) IgG-specific endopeptidase IdeS (Sib38) {Streptococcus pyogenes [TaxId: 1314]}
tsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllsgaatagnmlhwwfd
qnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylkhlg
vfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdfkek
nlkeisdlikkeltegkalglshtyrinhvinlwgadfdsngnlkaiyvtdsdsnasigm
kkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqtn

Timeline for d1y08a_:

• d1y08a_ first appeared in SCOP 1.71
  
• d1y08a_ appears in SCOPe 2.02
  
• d1y08a_ appears in SCOPe 2.04
  
• d1y08a_ appears in the current release, SCOPe 2.08