SCOP 1.71: Domain d1xx9d_: 1xx9 D:

Lineage for d1xx9d_ (1xx9 D:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)

8. Domain d1xx9d_: 1xx9 D: [116152]
   Other proteins in same PDB: d1xx9a_, d1xx9b_
   complexed with nag; mutant

Details for d1xx9d_

PDB Entry: 1xx9, 2.2 Å

PDB Description: crystal structure of the fxia catalytic domain in complex with ecotinm84r

SCOP Domain Sequences for d1xx9d_:

Sequence; same for both SEQRES and ATOM records:

>d1xx9d_ b.16.1.1 (D:) Ecotin, trypsin inhibitor {Escherichia coli}
vqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenkt
legwgydyyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnv
dvkyrvwkaeekidnavvr

Timeline for d1xx9d_:

• d1xx9d_ is new in SCOP 1.71
  
• d1xx9d_ appears in SCOP 1.73
  
• d1xx9d_ appears in the current release, SCOPe 2.08