![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology with the crossing loops |
![]() | Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) ![]() |
![]() | Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein) |
![]() | Protein Ecotin, trypsin inhibitor [49774] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49775] (17 PDB entries) |
![]() | Domain d1xx9d_: 1xx9 D: [116152] Other proteins in same PDB: d1xx9a_, d1xx9b_ complexed with nag; mutant |
PDB Entry: 1xx9 (more details), 2.2 Å
SCOP Domain Sequences for d1xx9d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xx9d_ b.16.1.1 (D:) Ecotin, trypsin inhibitor {Escherichia coli} vqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenkt legwgydyyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnv dvkyrvwkaeekidnavvr
Timeline for d1xx9d_: