![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
![]() | Protein Coagulation factor XI [117237] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117238] (3 PDB entries) |
![]() | Domain d1xx9b_: 1xx9 B: [116150] Other proteins in same PDB: d1xx9c_, d1xx9d_ complexed with nag; mutant |
PDB Entry: 1xx9 (more details), 2.2 Å
SCOP Domain Sequences for d1xx9b_:
Sequence, based on SEQRES records: (download)
>d1xx9b_ b.47.1.2 (B:) Coagulation factor XI {Human (Homo sapiens)} ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpiclpskgdr nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav
>d1xx9b_ b.47.1.2 (B:) Coagulation factor XI {Human (Homo sapiens)} ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpiclpskgyt dcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyreggkdack gdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav
Timeline for d1xx9b_: