Lineage for d1xwka1 (1xwk A:85-217)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326216Protein Class mu GST [81348] (3 species)
  7. 2326224Species Human (Homo sapiens) [TaxId:9606] [47622] (16 PDB entries)
    Uniprot P09488 P28161
  8. 2326246Domain d1xwka1: 1xwk A:85-217 [116126]
    Other proteins in same PDB: d1xwka2, d1xwkb2, d1xwkc2
    complexed with gdn

Details for d1xwka1

PDB Entry: 1xwk (more details), 2.3 Å

PDB Description: 2.3 angstrom resolution crystal structure of human glutathione s- transferase m1a-1a complexed with glutathionyl-s-dinitrobenzene
PDB Compounds: (A:) Glutathione S-transferase Mu 1

SCOPe Domain Sequences for d1xwka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwka1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

SCOPe Domain Coordinates for d1xwka1:

Click to download the PDB-style file with coordinates for d1xwka1.
(The format of our PDB-style files is described here.)

Timeline for d1xwka1: